(data stored in ACNUC7421 zone)

EMBL: CP000088.PE60

CP000088.PE60        Location/Qualifiers
FT   CDS             complement(74123..75454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54100"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54100.1"
FT                   /translation="MTETPVPSLTIRSKDRGPLLDALRNGVVPYRGAHLIQVGRGRELE
FT                   ALHTSIKQIKNGAGAVRFVIGDYGAGKTFFLHLVRSIAHKEDLVTVHADLTPDRRLQGS
FT                   QGRARRLYSTLMANMATRGKPGGRALTTVVEKFVTQVRRDAEANGTTVEHQLSERLWGL
FT                   REFPGGPSFAKVIEAYWRSHVHQDEELRAHALRWLSAEYAKKTEASRDLGVSEIIDDRS
FT                   LFDHLKLMAAFTTMAGYRGLLVCFDELVNLYKLSHKGSRHANYEQILNIINDTQQGRAE
FT                   YIGFLFGGTPEFLEDPLRGLYSYEALRSRLEENPYATGGLVDFHGPVMRLSHFTKEHFY
FT                   ELLRKVRHVYASGDPAKHPLPDEAIEAFMRHCEERVGDAYFRTPRSTIKQFIGLMDVLV
FT                   QNENADWRTLLTQMEVVKETNPDLQPLDPKDDVENDSPLASFRL"
     MTETPVPSLT IRSKDRGPLL DALRNGVVPY RGAHLIQVGR GRELEALHTS IKQIKNGAGA        60
     VRFVIGDYGA GKTFFLHLVR SIAHKEDLVT VHADLTPDRR LQGSQGRARR LYSTLMANMA       120
     TRGKPGGRAL TTVVEKFVTQ VRRDAEANGT TVEHQLSERL WGLREFPGGP SFAKVIEAYW       180
     RSHVHQDEEL RAHALRWLSA EYAKKTEASR DLGVSEIIDD RSLFDHLKLM AAFTTMAGYR       240
     GLLVCFDELV NLYKLSHKGS RHANYEQILN IINDTQQGRA EYIGFLFGGT PEFLEDPLRG       300
     LYSYEALRSR LEENPYATGG LVDFHGPVMR LSHFTKEHFY ELLRKVRHVY ASGDPAKHPL       360
     PDEAIEAFMR HCEERVGDAY FRTPRSTIKQ FIGLMDVLVQ NENADWRTLL TQMEVVKETN       420
     PDLQPLDPKD DVENDSPLAS FRL                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page