(data stored in ACNUC7421 zone)

EMBL: CP000088.PE600

CP000088.PE600       Location/Qualifiers
FT   CDS             691632..692660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54640"
FT                   /db_xref="GOA:Q47SC7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54640.1"
FT                   /translation="MNEEQRHPWQPEAYTGIGSWPGTDPGEAIRTILGELPHLPHLPEL
FT                   PGRGPGADMIGRTGALLVELPIEVQPSGWRVTQRAGRDLTRARSFLSWDLDALEEHTSG
FT                   YTGPLKIQATGPWTMAASVELRNGEKMIADLGAVADLCESFREGLLAHLAEVRKRVPEA
FT                   TILVQVDEPSLPAVLTGSVPTASGYGRLRAVDRVLVEERLRALFSAIDTAGGYPLVHCC
FT                   APRVPVDLLRRCGARALSLDATRLTRESDEAIGTAVESGVGLLLGVVPAVDSRMSPPVD
FT                   TVEPVRELWHRIGFDPEHATRDVVITPVCGLAGASPRHARAALDLCREAARVLREEPRP
FT                   RQ"
     MNEEQRHPWQ PEAYTGIGSW PGTDPGEAIR TILGELPHLP HLPELPGRGP GADMIGRTGA        60
     LLVELPIEVQ PSGWRVTQRA GRDLTRARSF LSWDLDALEE HTSGYTGPLK IQATGPWTMA       120
     ASVELRNGEK MIADLGAVAD LCESFREGLL AHLAEVRKRV PEATILVQVD EPSLPAVLTG       180
     SVPTASGYGR LRAVDRVLVE ERLRALFSAI DTAGGYPLVH CCAPRVPVDL LRRCGARALS       240
     LDATRLTRES DEAIGTAVES GVGLLLGVVP AVDSRMSPPV DTVEPVRELW HRIGFDPEHA       300
     TRDVVITPVC GLAGASPRHA RAALDLCREA ARVLREEPRP RQ                          342
//

If you have problems or comments...

PBIL Back to PBIL home page