(data stored in ACNUC7421 zone)

EMBL: CP000088.PE604

CP000088.PE604       Location/Qualifiers
FT   CDS             697648..699144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0606"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54644"
FT                   /db_xref="GOA:Q47SC3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54644.1"
FT                   /translation="MTELLKLSAAELGAAIASGETSAVEATQAYLDRIAEVDGQIHAFL
FT                   HVAADKALEQARAVDARRAAGEKLGPLAGVPVAHKDVFTTKDMPTTAASKILEGWQSPY
FT                   DATVTERLRDAGLVILGKTNLDEFAMGSSTENSAYGPTRNPWDTDRVPGGSSGGSSAAV
FT                   AAFEAPLATGTDTGGSIRQPAAVCGLVGAKPTYGTSSRYGLIAFASSLDTPGPIARNVL
FT                   DAALLHEAFSGHDPRDSTSVNEPVPPVVEAARRADVSGMRIGVVKELSGEGYQPGVMQR
FT                   FTEAVELFESLGAKIVEVSCPSFTAALAAYYLIAPSECSSNLARFDAMRYGLRVGDDGT
FT                   RSADEVMALTRAQGFGPEVKRRIILGTYALSSGYYDAYYGSAQKVRTLIKRDFEAAFQQ
FT                   ADVLVSPTTPTTAFRLGERIDDPMAMYLADLCTIPTNLAGNAALSVPCGLAPEDNMPVG
FT                   LHIMAPTLADDRAYQAGAAVEAALRDKWGGDLLSQCAYAV"
     MTELLKLSAA ELGAAIASGE TSAVEATQAY LDRIAEVDGQ IHAFLHVAAD KALEQARAVD        60
     ARRAAGEKLG PLAGVPVAHK DVFTTKDMPT TAASKILEGW QSPYDATVTE RLRDAGLVIL       120
     GKTNLDEFAM GSSTENSAYG PTRNPWDTDR VPGGSSGGSS AAVAAFEAPL ATGTDTGGSI       180
     RQPAAVCGLV GAKPTYGTSS RYGLIAFASS LDTPGPIARN VLDAALLHEA FSGHDPRDST       240
     SVNEPVPPVV EAARRADVSG MRIGVVKELS GEGYQPGVMQ RFTEAVELFE SLGAKIVEVS       300
     CPSFTAALAA YYLIAPSECS SNLARFDAMR YGLRVGDDGT RSADEVMALT RAQGFGPEVK       360
     RRIILGTYAL SSGYYDAYYG SAQKVRTLIK RDFEAAFQQA DVLVSPTTPT TAFRLGERID       420
     DPMAMYLADL CTIPTNLAGN AALSVPCGLA PEDNMPVGLH IMAPTLADDR AYQAGAAVEA       480
     ALRDKWGGDL LSQCAYAV                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page