(data stored in ACNUC7421 zone)

EMBL: CP000088.PE605

CP000088.PE605       Location/Qualifiers
FT   CDS             complement(699303..700547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0607"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54645"
FT                   /db_xref="GOA:Q47SC2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54645.1"
FT                   /translation="MLTTDSSSRTPRGVRRALVTVAGTATAAFLAFGMSAAPAFADHYS
FT                   GGADAQYTGNVASGHTLSFDRGSVGTVLFQLTLSDGTKIPAYCIDFETPIRSKAKYEEG
FT                   DWSEYPGEGEFANSQPGKVLWILQNSYPELSADQLSERTGIKDLTAKDALSATQAAIWH
FT                   FSNGVNLKEKGTPKKVWKLYNYLIENATEIQQAPASLTISPNEASGESGGLIGEFTVST
FT                   TASSVPLTLNGPEGVQTVDLEGNPVTEVGNEDKFSVLVPEGTADGEATVSASVSATVEI
FT                   GRLFKGLQGDPPTQTLITADKAETTASAEVKVTWTAPAPSDDETPGDDETPGDDETPGD
FT                   DETPGDDETPTPGDDETPPATESPKPTPPADDKPGLPVTGAALGGLIAAAVVAVGGGGA
FT                   AMYLARKRKSNADDA"
     MLTTDSSSRT PRGVRRALVT VAGTATAAFL AFGMSAAPAF ADHYSGGADA QYTGNVASGH        60
     TLSFDRGSVG TVLFQLTLSD GTKIPAYCID FETPIRSKAK YEEGDWSEYP GEGEFANSQP       120
     GKVLWILQNS YPELSADQLS ERTGIKDLTA KDALSATQAA IWHFSNGVNL KEKGTPKKVW       180
     KLYNYLIENA TEIQQAPASL TISPNEASGE SGGLIGEFTV STTASSVPLT LNGPEGVQTV       240
     DLEGNPVTEV GNEDKFSVLV PEGTADGEAT VSASVSATVE IGRLFKGLQG DPPTQTLITA       300
     DKAETTASAE VKVTWTAPAP SDDETPGDDE TPGDDETPGD DETPGDDETP TPGDDETPPA       360
     TESPKPTPPA DDKPGLPVTG AALGGLIAAA VVAVGGGGAA MYLARKRKSN ADDA             414
//

If you have problems or comments...

PBIL Back to PBIL home page