(data stored in ACNUC7421 zone)

EMBL: CP000088.PE73

CP000088.PE73        Location/Qualifiers
FT   CDS             95583..96356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0075"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54113"
FT                   /db_xref="GOA:Q47TV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54113.1"
FT                   /translation="MMTSPTPSPPAPVLVLNDLSWSVGGAVIVDGVSMTVSDGEFLAVI
FT                   GPNGAGKTSLFNLVSGLTRPTRGTVELLGTDITRLPPHRRARLGLGRTFQTSSVFADLS
FT                   VGANVGLAVQARLGESRRFWQRATPVTGPEISRVLDLVRLSHRADALAGDLSHGDKRKL
FT                   ELALLLAREPRVILLDEPMAGVSAGEIGELVDVIRTVHREQGCTVLMVEHHMEVLLDMA
FT                   DRLAVMHHGALLALADPDTAMADSRVQAAYLGDAL"
     MMTSPTPSPP APVLVLNDLS WSVGGAVIVD GVSMTVSDGE FLAVIGPNGA GKTSLFNLVS        60
     GLTRPTRGTV ELLGTDITRL PPHRRARLGL GRTFQTSSVF ADLSVGANVG LAVQARLGES       120
     RRFWQRATPV TGPEISRVLD LVRLSHRADA LAGDLSHGDK RKLELALLLA REPRVILLDE       180
     PMAGVSAGEI GELVDVIRTV HREQGCTVLM VEHHMEVLLD MADRLAVMHH GALLALADPD       240
     TAMADSRVQA AYLGDAL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page