(data stored in ACNUC7421 zone)

EMBL: CP000088.PE76

CP000088.PE76        Location/Qualifiers
FT   CDS             97989..99113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0078"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54116"
FT                   /db_xref="GOA:Q47TU8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54116.1"
FT                   /translation="MNVDTDTKHTTEAPAAPAAPVAEAVRRPRRVPAWVAPAVVAVVLL
FT                   SLPFSTLRIPGLFEGTLNSPSTLHVLATCLVLGGLATSYDLLYGRVGLLSFGHALYFAA
FT                   GAYLAVLLMGILELPLLWSALIAVASGTLLALVLGAISLRVSGIALAMVTLAFAQAGSI
FT                   LVVRDPGRMTGGEEGLSLNPDLVPDAFIGVVNTVNLYWLAVGYVVVALGVVWWLSATPV
FT                   GRVWQGIRANEQRVSVLGVNPYPYKLAAFTVAGALASLGGVVYLVVSGGVTPAITTAEF
FT                   TLTLLVMVSLGGAGTRWGPLVGAVVYTYVDHRLLQLAASDVFDGLPAVVRAPLSQPLFI
FT                   LGTLFVLLVFFFPGGLAALPSRIHAALRRRAAAA"
     MNVDTDTKHT TEAPAAPAAP VAEAVRRPRR VPAWVAPAVV AVVLLSLPFS TLRIPGLFEG        60
     TLNSPSTLHV LATCLVLGGL ATSYDLLYGR VGLLSFGHAL YFAAGAYLAV LLMGILELPL       120
     LWSALIAVAS GTLLALVLGA ISLRVSGIAL AMVTLAFAQA GSILVVRDPG RMTGGEEGLS       180
     LNPDLVPDAF IGVVNTVNLY WLAVGYVVVA LGVVWWLSAT PVGRVWQGIR ANEQRVSVLG       240
     VNPYPYKLAA FTVAGALASL GGVVYLVVSG GVTPAITTAE FTLTLLVMVS LGGAGTRWGP       300
     LVGAVVYTYV DHRLLQLAAS DVFDGLPAVV RAPLSQPLFI LGTLFVLLVF FFPGGLAALP       360
     SRIHAALRRR AAAA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page