(data stored in ACNUC7421 zone)

EMBL: CP000088.PE8

CP000088.PE8         Location/Qualifiers
FT   CDS             11738..12430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0008"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54048"
FT                   /db_xref="GOA:Q47U16"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54048.1"
FT                   /translation="MSDNAQRESAAVEPNPANTDKSGVDAARTTEVEGPETETLGTATD
FT                   SDEVTGAGGPETTGGAEGESPESADAAEASTSEAAQGGSDMAAEAVAASPSAESKTAKT
FT                   AARKAHLTLSRIEPWSVMKFSFIISLVCFIILFVAVAVLYTGLEVLGVFDAVTELITSL
FT                   TEGDEVSEEFIINPEVWFSPTRILGYTALFGALNVILITALATAGAMLYNLSADLVGGI
FT                   DVTLSETE"
     MSDNAQRESA AVEPNPANTD KSGVDAARTT EVEGPETETL GTATDSDEVT GAGGPETTGG        60
     AEGESPESAD AAEASTSEAA QGGSDMAAEA VAASPSAESK TAKTAARKAH LTLSRIEPWS       120
     VMKFSFIISL VCFIILFVAV AVLYTGLEVL GVFDAVTELI TSLTEGDEVS EEFIINPEVW       180
     FSPTRILGYT ALFGALNVIL ITALATAGAM LYNLSADLVG GIDVTLSETE                  230
//

If you have problems or comments...

PBIL Back to PBIL home page