(data stored in ACNUC7421 zone)

EMBL: CP000088.PE82

CP000088.PE82        Location/Qualifiers
FT   CDS             complement(106919..107650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54122"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54122.1"
FT                   /translation="MTEQLSPMPEDWQRALAVVAHPDDLEYGAAAAIAAWTDAGKEVSY
FT                   LLATRGEAGIDGIHPSKAAPLREREQIASAAVVGVTTVEFLDYRDGVIEYGLPLRRNIA
FT                   AAIRRHRPELVITLNHRDTFHGGFWNTPDHKAVGRATLDAATDAGNRWIFPELVDQGLE
FT                   PWNGVRWVAVAASPQPTHAVDATPGYERAVRSLLEHRAYIEGLTDEDPETYVRSFLDET
FT                   LSANAPRFGGRLAVTFELFPR"
     MTEQLSPMPE DWQRALAVVA HPDDLEYGAA AAIAAWTDAG KEVSYLLATR GEAGIDGIHP        60
     SKAAPLRERE QIASAAVVGV TTVEFLDYRD GVIEYGLPLR RNIAAAIRRH RPELVITLNH       120
     RDTFHGGFWN TPDHKAVGRA TLDAATDAGN RWIFPELVDQ GLEPWNGVRW VAVAASPQPT       180
     HAVDATPGYE RAVRSLLEHR AYIEGLTDED PETYVRSFLD ETLSANAPRF GGRLAVTFEL       240
     FPR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page