(data stored in ACNUC7421 zone)

EMBL: CP000088.PE83

CP000088.PE83        Location/Qualifiers
FT   CDS             107759..108214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54123"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54123.1"
FT                   /translation="MVISEADFAKSSIMAAMPLARILGVEFVELAEERAVMRLPDNPDH
FT                   YDHTQNQHAGALIVLAETTSGAAVFNALGDRLKLALPVSLDARVDHRQPFSGPVVAEAV
FT                   LGEEWRTALTELEAGGQPEFPVDVALRAENGSTTGTATITWMLRPHP"
     MVISEADFAK SSIMAAMPLA RILGVEFVEL AEERAVMRLP DNPDHYDHTQ NQHAGALIVL        60
     AETTSGAAVF NALGDRLKLA LPVSLDARVD HRQPFSGPVV AEAVLGEEWR TALTELEAGG       120
     QPEFPVDVAL RAENGSTTGT ATITWMLRPH P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page