(data stored in ACNUC7421 zone)

EMBL: CP000088.PE88

CP000088.PE88        Location/Qualifiers
FT   CDS             112611..113462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0090"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54128"
FT                   /db_xref="GOA:Q47TT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54128.1"
FT                   /translation="MREPSGDYSPTIRRRRLSEELRRLRLARGLTLEQVAEKLEWSRAK
FT                   IANIETGKRLRPYVTDVELLLNVYGVDDPDQRAALLDLTRQSRTKGWWASYGGLLGDYV
FT                   GMEAEASSIATYQLGAIPGLLQTFDYAVALAQAMRYPPEDVERIAASRVRRQQLFARKN
FT                   PPRFHAVIDEAALIRPAAPDRPDVMRAQIHHLINRANDANVTLQLLPFTAGLHAGVSGP
FT                   FVLLEFPDPADRPVVYLETRAGGHYLEDTAEITEYQDLFTHLHTTALSHEATVARLAQL
FT                   AE"
     MREPSGDYSP TIRRRRLSEE LRRLRLARGL TLEQVAEKLE WSRAKIANIE TGKRLRPYVT        60
     DVELLLNVYG VDDPDQRAAL LDLTRQSRTK GWWASYGGLL GDYVGMEAEA SSIATYQLGA       120
     IPGLLQTFDY AVALAQAMRY PPEDVERIAA SRVRRQQLFA RKNPPRFHAV IDEAALIRPA       180
     APDRPDVMRA QIHHLINRAN DANVTLQLLP FTAGLHAGVS GPFVLLEFPD PADRPVVYLE       240
     TRAGGHYLED TAEITEYQDL FTHLHTTALS HEATVARLAQ LAE                         283
//

If you have problems or comments...

PBIL Back to PBIL home page