(data stored in ACNUC7421 zone)

EMBL: CP000088.PE91

CP000088.PE91        Location/Qualifiers
FT   CDS             complement(115018..115446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54131"
FT                   /db_xref="GOA:Q47TT3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54131.1"
FT                   /translation="MPGTALLHQFRHQRIALLTTYLNNGKTPVHTPVSIALDGDRLLFR
FT                   VGKDSSTAARMTENPLVDLRTCTFRGEPTGAPVRGRVRPLSGEEAHRAARLLARGHLIT
FT                   RRWMLPLSYRMLRYEPVHYELLPVGDDAGDNPVEKVAG"
     MPGTALLHQF RHQRIALLTT YLNNGKTPVH TPVSIALDGD RLLFRVGKDS STAARMTENP        60
     LVDLRTCTFR GEPTGAPVRG RVRPLSGEEA HRAARLLARG HLITRRWMLP LSYRMLRYEP       120
     VHYELLPVGD DAGDNPVEKV AG                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page