(data stored in ACNUC7421 zone)

EMBL: CP000088.PE95

CP000088.PE95        Location/Qualifiers
FT   CDS             complement(118103..119002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54135"
FT                   /db_xref="GOA:Q47TS9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54135.1"
FT                   /translation="MVTAGDGDGWVILADGSRRWGLYGASGLLLYSVDESGTGHVLLQH
FT                   RAPWTHQGGTWGLPGGARNSGESSVSAAIREFVEEVDGDLGTLSLLGIHRQDHQVWVFD
FT                   TVLASVPERRPFTPGNPESESIRWIPVPDVPSMPLLPAFGKVWPEVAAALSEQLLLIVD
FT                   TTVVPQSITPGALCHRLTELAQVGVTDDMLPPDVPLTPLHRRFPSVLLLVDAHSRAALP
FT                   APVHGVDVVQVSDGSAAAIAQLVSERLPQTRIVVATDHPDTRAQAAALGVHTAPVSWAY
FT                   ELAQREESSPVERGSSVT"
     MVTAGDGDGW VILADGSRRW GLYGASGLLL YSVDESGTGH VLLQHRAPWT HQGGTWGLPG        60
     GARNSGESSV SAAIREFVEE VDGDLGTLSL LGIHRQDHQV WVFDTVLASV PERRPFTPGN       120
     PESESIRWIP VPDVPSMPLL PAFGKVWPEV AAALSEQLLL IVDTTVVPQS ITPGALCHRL       180
     TELAQVGVTD DMLPPDVPLT PLHRRFPSVL LLVDAHSRAA LPAPVHGVDV VQVSDGSAAA       240
     IAQLVSERLP QTRIVVATDH PDTRAQAAAL GVHTAPVSWA YELAQREESS PVERGSSVT        299
//

If you have problems or comments...

PBIL Back to PBIL home page