(data stored in ACNUC7421 zone)

EMBL: CP000088.PE96

CP000088.PE96        Location/Qualifiers
FT   CDS             119935..120546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54136"
FT                   /db_xref="GOA:Q47TS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54136.1"
FT                   /translation="MTNGPFPSESPSPQPSDGQGSTSGNIPEPVTQLAAQRGFGALIDM
FT                   RSDGTRAEKALGGCAIAVGSLLLMVLVAYLAPEDDPFSFSLLRSVLRFFALFFLFVAVW
FT                   AAAAGLRGLIVAPRSHYLYEGGIIYAAGKRLQPAAWEEISHLTTIYGNRATGTKGKILG
FT                   YKVWLGDTTSFDVPLILTDGRDSFMDRIIHEVRSRNRPIR"
     MTNGPFPSES PSPQPSDGQG STSGNIPEPV TQLAAQRGFG ALIDMRSDGT RAEKALGGCA        60
     IAVGSLLLMV LVAYLAPEDD PFSFSLLRSV LRFFALFFLF VAVWAAAAGL RGLIVAPRSH       120
     YLYEGGIIYA AGKRLQPAAW EEISHLTTIY GNRATGTKGK ILGYKVWLGD TTSFDVPLIL       180
     TDGRDSFMDR IIHEVRSRNR PIR                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page