(data stored in ACNUC7421 zone)

EMBL: CP000088.PE97

CP000088.PE97        Location/Qualifiers
FT   CDS             120568..120924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54137"
FT                   /db_xref="GOA:Q47TS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54137.1"
FT                   /translation="MAEQHTPEPHSSNRPQPEPVPNAEHTDAALSPSAEPPPYVPRPEA
FT                   LRHDLKVRGERAVIFGALWLLAGVLITLITYVNALQSFSGGIYVVAWGPAVYGLYRIIS
FT                   GLIMIKKSRTQSVN"
     MAEQHTPEPH SSNRPQPEPV PNAEHTDAAL SPSAEPPPYV PRPEALRHDL KVRGERAVIF        60
     GALWLLAGVL ITLITYVNAL QSFSGGIYVV AWGPAVYGLY RIISGLIMIK KSRTQSVN         118
//

If you have problems or comments...

PBIL Back to PBIL home page