(data stored in ACNUC7421 zone)

EMBL: CP000088.PE99

CP000088.PE99        Location/Qualifiers
FT   CDS             complement(123472..124254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54139"
FT                   /db_xref="GOA:Q47TS5"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54139.1"
FT                   /translation="MTLSSATAPPRSPRRLPGVRWNRTSLVVAITAFACVLVAAIFVPP
FT                   YLSLDPGSSRVALRPDSALHFPAVAIHAATGGIALLTGPLQFSRRLRRRGVWHRWIGRV
FT                   YLFAGVLPSALSGIVAALLTSSGPVAMAAFLSLDILWIITGLAAYRTARAGRYAAHREW
FT                   MLRNFSLTFAAVTLRIWLSALVAIQLPWLDSLYGGDFDQLFATAYAVSHWTSWLPNLLL
FT                   VEVYLARQAARQAREALATALQTTAAAADNTETSPTPA"
     MTLSSATAPP RSPRRLPGVR WNRTSLVVAI TAFACVLVAA IFVPPYLSLD PGSSRVALRP        60
     DSALHFPAVA IHAATGGIAL LTGPLQFSRR LRRRGVWHRW IGRVYLFAGV LPSALSGIVA       120
     ALLTSSGPVA MAAFLSLDIL WIITGLAAYR TARAGRYAAH REWMLRNFSL TFAAVTLRIW       180
     LSALVAIQLP WLDSLYGGDF DQLFATAYAV SHWTSWLPNL LLVEVYLARQ AARQAREALA       240
     TALQTTAAAA DNTETSPTPA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page