(data stored in ACNUC7421 zone)

EMBL: CP000094.LAPB

CP000094.LAPB        Location/Qualifiers
FT   CDS             162378..164543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapB"
FT                   /locus_tag="Pfl01_0135"
FT                   /product="ATP binding cassette protein component of ABC
FT                   transporter required for LapA secretion"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71879"
FT                   /db_xref="GOA:Q3KK27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK27"
FT                   /protein_id="ABA71879.1"
FT                   /translation="MSSVESEVSRVHLSHDPRALHDDPLLDGLLALCMLHQKPASAAML
FT                   TTGLPLPKQRLSVELLPRAAARAGLQGRVLQRKLEEIPAIAMPALLLLKDGRSAVLLGW
FT                   QGENEARVLLSESDGGESLVSRELLADDYTGKVFFAQPQHKFDVNHGTLIPRARSWFRD
FT                   TLKRSRWLYADAIAASFLINIIAMAAPLFVMNVYDRVVPNQAEATLWVLALGITGAYLF
FT                   DLILKSLRSLCLDLAGKKTDLIISATLFERIVGMAMKYRPARVGSFAQNIHEFQSLRDF
FT                   LASLTLTSLIDLPFTLLIFIVIAILGGHLVWIPVLAFPIALLIGYALQKPLVATMERTM
FT                   ALGAERQSSLIETLAGLDAVKVNNAESERQYQWEQTIGTLSRLELRVKMLSGLAMNITL
FT                   LIQQLAGVIMIVFGVYQIIAGNLSMGGLIACYMLSGRALSPLASLSGLLTRYQQARVTM
FT                   TSVDQMMELPQERNFEERPLSRKVLQGAIECRQLSFTYPEQQNPALKNINLVIRPGEKI
FT                   GIIGRSGSGKSSLAKLLVGLYQPDDGALLVDGVDIRQIDVSELRYNIGYVPQDIQLLAG
FT                   TLRDNLISGARYVEDELVLQAAELAGVHEFARLHPQGYELQVGERGQNLSGGQRQNVAL
FT                   ARALLLNPPILLLDEPTSAMDNTGEERLKQRLAAVVENKTVVLVTHRASLLSLVDRLLV
FT                   VDRGQILADGPKAAVMEALKKGQISVA"
     MSSVESEVSR VHLSHDPRAL HDDPLLDGLL ALCMLHQKPA SAAMLTTGLP LPKQRLSVEL        60
     LPRAAARAGL QGRVLQRKLE EIPAIAMPAL LLLKDGRSAV LLGWQGENEA RVLLSESDGG       120
     ESLVSRELLA DDYTGKVFFA QPQHKFDVNH GTLIPRARSW FRDTLKRSRW LYADAIAASF       180
     LINIIAMAAP LFVMNVYDRV VPNQAEATLW VLALGITGAY LFDLILKSLR SLCLDLAGKK       240
     TDLIISATLF ERIVGMAMKY RPARVGSFAQ NIHEFQSLRD FLASLTLTSL IDLPFTLLIF       300
     IVIAILGGHL VWIPVLAFPI ALLIGYALQK PLVATMERTM ALGAERQSSL IETLAGLDAV       360
     KVNNAESERQ YQWEQTIGTL SRLELRVKML SGLAMNITLL IQQLAGVIMI VFGVYQIIAG       420
     NLSMGGLIAC YMLSGRALSP LASLSGLLTR YQQARVTMTS VDQMMELPQE RNFEERPLSR       480
     KVLQGAIECR QLSFTYPEQQ NPALKNINLV IRPGEKIGII GRSGSGKSSL AKLLVGLYQP       540
     DDGALLVDGV DIRQIDVSEL RYNIGYVPQD IQLLAGTLRD NLISGARYVE DELVLQAAEL       600
     AGVHEFARLH PQGYELQVGE RGQNLSGGQR QNVALARALL LNPPILLLDE PTSAMDNTGE       660
     ERLKQRLAAV VENKTVVLVT HRASLLSLVD RLLVVDRGQI LADGPKAAVM EALKKGQISV       720
     A                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page