(data stored in ACNUC7421 zone)

EMBL: CP000094.MSRA

CP000094.MSRA        Location/Qualifiers
FT   CDS             complement(526067..526732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Pfl01_0459"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72203"
FT                   /db_xref="GOA:Q3KJ53"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ53"
FT                   /protein_id="ABA72203.1"
FT                   /translation="MVLRSEILVNKNVLPTKEQALPGRETPMALPEKHFVFTETPLLGP
FT                   FFQDVDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPNPTYEEVCSGLTGHAEVV
FT                   LVVFDKAKVSYEELLAMFWELHNPTQGMRQGNDIGTQYRSVIYATHPEQLDAALKSKAV
FT                   YQAELSKAGLGEISTEIEQAPTVYFAETYHQQYLAKNPEGYCGIGGTGVCMPPSLAGN"
     MVLRSEILVN KNVLPTKEQA LPGRETPMAL PEKHFVFTET PLLGPFFQDV DFAIFGLGCF        60
     WGAERRFWQR EGVVSTVVGY AGGFTPNPTY EEVCSGLTGH AEVVLVVFDK AKVSYEELLA       120
     MFWELHNPTQ GMRQGNDIGT QYRSVIYATH PEQLDAALKS KAVYQAELSK AGLGEISTEI       180
     EQAPTVYFAE TYHQQYLAKN PEGYCGIGGT GVCMPPSLAG N                           221
//

If you have problems or comments...

PBIL Back to PBIL home page