(data stored in ACNUC7421 zone)

EMBL: CP000094.PE101

CP000094.PE101       Location/Qualifiers
FT   CDS             104397..104723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71845"
FT                   /db_xref="GOA:Q3KK61"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK61"
FT                   /protein_id="ABA71845.1"
FT                   /translation="MANTSLRKASLQSMEAEIESLLKSLESLKDDASDESRKTLKALKS
FT                   NAESALKHSRSLLSDAYEEVKVKTRETGIATRDYAQEHPWTTAGVAVGALGLLAAYLLF
FT                   KRGE"
     MANTSLRKAS LQSMEAEIES LLKSLESLKD DASDESRKTL KALKSNAESA LKHSRSLLSD        60
     AYEEVKVKTR ETGIATRDYA QEHPWTTAGV AVGALGLLAA YLLFKRGE                    108
//

If you have problems or comments...

PBIL Back to PBIL home page