(data stored in ACNUC7421 zone)

EMBL: CP000094.PE108

CP000094.PE108       Location/Qualifiers
FT   CDS             complement(110713..111021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0108"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71852"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK54"
FT                   /protein_id="ABA71852.1"
FT                   /translation="MRFLTNLLIPSVLITACWVPLADAFDVSTQNTVVSVWATGMVSSA
FT                   PFDRKLIVAAHDDAAAFVASDGQMRGAQLESALHYLRKSRPKLHVSDLELAQAILVQ"
     MRFLTNLLIP SVLITACWVP LADAFDVSTQ NTVVSVWATG MVSSAPFDRK LIVAAHDDAA        60
     AFVASDGQMR GAQLESALHY LRKSRPKLHV SDLELAQAIL VQ                          102
//

If you have problems or comments...

PBIL Back to PBIL home page