(data stored in ACNUC7421 zone)

EMBL: CP000094.PE112

CP000094.PE112       Location/Qualifiers
FT   CDS             complement(114025..115458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0112"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71856"
FT                   /db_xref="GOA:Q3KK50"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK50"
FT                   /protein_id="ABA71856.1"
FT                   /translation="MSMNLVTTLYLIASICFIQALKGLSHPTTSRRGNLFGMLGMALAI
FT                   ITTIGLIYKLGAELATAGIGYVIVGLLIGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVVEPQSLGIVKQLGDSIPAGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGAPVQFSGQHKLNAVLGLATLILGVTFMLTGNLAAFALMLALAFVMGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVLLGGFGNTADAGPAGEKEARPVKSGSADDATFLLTNADTVIIVPGYGLAVARAQHAL
FT                   KELTEKLTHHGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQADVV
FT                   LVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLDNELFYLDKT
FT                   MMVFGDAKKVIEDMVKAVE"
     MSMNLVTTLY LIASICFIQA LKGLSHPTTS RRGNLFGMLG MALAIITTIG LIYKLGAELA        60
     TAGIGYVIVG LLIGGTAGSI MAKRVEMTKM PELVAFMHSM IGLAAVFIAI AAVVEPQSLG       120
     IVKQLGDSIP AGNRLELFLG AAIGAITFSG SVIAFGKLSG KYKFRLFQGA PVQFSGQHKL       180
     NAVLGLATLI LGVTFMLTGN LAAFALMLAL AFVMGVLIII PIGGADMPVV VSMLNSYSGW       240
     AAAGIGFSLN NSMLIIAGSL VGSSGAILSY IMCKAMNRSF FNVLLGGFGN TADAGPAGEK       300
     EARPVKSGSA DDATFLLTNA DTVIIVPGYG LAVARAQHAL KELTEKLTHH GVTVKYAIHP       360
     VAGRMPGHMN VLLAEAEVPY DQVFEMEDIN SEFGQADVVL VLGANDVVNP AAKNDPKSPI       420
     AGMPILEAFK AKTIIVNKRS MASGYAGLDN ELFYLDKTMM VFGDAKKVIE DMVKAVE          477
//

If you have problems or comments...

PBIL Back to PBIL home page