(data stored in ACNUC7421 zone)

EMBL: CP000094.PE114

CP000094.PE114       Location/Qualifiers
FT   CDS             complement(115794..116915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0114"
FT                   /product="NAD(P) transhydrogenase subunit alpha 1"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71858"
FT                   /db_xref="GOA:Q3KK48"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK48"
FT                   /protein_id="ABA71858.1"
FT                   /translation="MHIGVPLETQTGETRVAATPETIKKLISQGHKVTVQTGAGVKASV
FT                   VDSAYEAAGATIGSANDAFGAELILKVVAPSDAELTLIKRGTVLVGMLNPFNNDTIAKM
FT                   AECGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHYYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAVGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSADTVAQMKP
FT                   GSVVIDLAAAQGGNCPLTVADQVVIENGVTIVGPTNLAGEVAADASALYARNLLDFLKL
FT                   VFTKEGQFEVNLEDDIVAACLMCRDGQVIRKNA"
     MHIGVPLETQ TGETRVAATP ETIKKLISQG HKVTVQTGAG VKASVVDSAY EAAGATIGSA        60
     NDAFGAELIL KVVAPSDAEL TLIKRGTVLV GMLNPFNNDT IAKMAECGIT AFALEAAPRT       120
     SRAQSLDVLS SQANIAGYKA VLLAAHYYPR FMPMLMTAAG TVKAARVLIL GAGVAGLQAI       180
     ATAKRLGAVI EASDVRPAVK EQIESLGAKF VDVPYETDEE RECAVGVGGY ARPMPASWMQ       240
     RQAQAVHERA KQADIVITTA LIPGRKAPTL LSADTVAQMK PGSVVIDLAA AQGGNCPLTV       300
     ADQVVIENGV TIVGPTNLAG EVAADASALY ARNLLDFLKL VFTKEGQFEV NLEDDIVAAC       360
     LMCRDGQVIR KNA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page