(data stored in ACNUC7421 zone)

EMBL: CP000094.PE116

CP000094.PE116       Location/Qualifiers
FT   CDS             complement(117350..118249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0116"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71860"
FT                   /db_xref="GOA:Q3KK46"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK46"
FT                   /protein_id="ABA71860.1"
FT                   /translation="MRRKIPSTTALISFEAAARHESFTKAAEELSLTQGAICRQIASLE
FT                   DFLSVELFRRSRRGVKLTEAGLSYSRRVATQLDAVERDTLSVMGQQGTNVIELAVVPTF
FT                   GTQWLLPRLKDFQLKHPEVTVNLTNRTRPFLFADTDFDAAIYFGDADWSGTESHRLMGE
FT                   NPMPVCSPALLGNKTHLTPDEIADLPLLQQTTRPYAWRQWFNSQHLNIPRDMTGPRYEL
FT                   FSMLAQAAMHDMGIALIPPFLIQRELAEKRLVIANPNALSSIKAYYLMIPERKVESASL
FT                   KAFRDWLVSQAHSYNLEE"
     MRRKIPSTTA LISFEAAARH ESFTKAAEEL SLTQGAICRQ IASLEDFLSV ELFRRSRRGV        60
     KLTEAGLSYS RRVATQLDAV ERDTLSVMGQ QGTNVIELAV VPTFGTQWLL PRLKDFQLKH       120
     PEVTVNLTNR TRPFLFADTD FDAAIYFGDA DWSGTESHRL MGENPMPVCS PALLGNKTHL       180
     TPDEIADLPL LQQTTRPYAW RQWFNSQHLN IPRDMTGPRY ELFSMLAQAA MHDMGIALIP       240
     PFLIQRELAE KRLVIANPNA LSSIKAYYLM IPERKVESAS LKAFRDWLVS QAHSYNLEE        299
//

If you have problems or comments...

PBIL Back to PBIL home page