(data stored in ACNUC7421 zone)

EMBL: CP000094.PE124

CP000094.PE124       Location/Qualifiers
FT   CDS             132635..134515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0124"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71868"
FT                   /db_xref="GOA:Q3KK38"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK38"
FT                   /protein_id="ABA71868.1"
FT                   /translation="MNLKFSHKILLAASGVVVLAFALFTLYNDYLQRNTIRQNLQSSVQ
FT                   QAGDLTASSVQNWMSGRILVLENLAQNVAHQGKNADFPGLVDQPAFTSNFQFTYVGQAN
FT                   GVFTQRPDAKMPDGYDPRQRPWYKQAVAADQTMLTPPYMAAVGGLVVTIAMPVKKNGEL
FT                   LGVVGGDLSLETLVKIINSVDFGGLGHAFLVSGDGQVIVSPDKDQVMKNLKDIYPNAGV
FT                   RIEKGNQNVVLNGQERILSFTPVAGLPNAEWYIGLSIDRDKAYAALSQFRTSAVIAMFV
FT                   AVGAIAVFLSLLITVLMRPLITMGRAMQDIAQGEGDLTRRLVVESKDEFGELGSSFNQF
FT                   VERIHASISEVSSATRHVHDLSQRVMASSNASIIGSDEQSARTNSVAAAINQLGAATQE
FT                   IARNAADASQHASGASEQADDGRQVVEQTIQAMTELSQKISLSCTQIETLNASTDNIGH
FT                   ILDVIKGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQESAEEIHKMIT
FT                   SLQVGSREAVTTMNASQASSEETVEVANQAGLRLVSVTQRIGEIDGMNQSVAAATEEQT
FT                   AVVETLNVDVNQINLLNQQSVANLNETLKDCDALSQQANRLKQLVDSFKI"
     MNLKFSHKIL LAASGVVVLA FALFTLYNDY LQRNTIRQNL QSSVQQAGDL TASSVQNWMS        60
     GRILVLENLA QNVAHQGKNA DFPGLVDQPA FTSNFQFTYV GQANGVFTQR PDAKMPDGYD       120
     PRQRPWYKQA VAADQTMLTP PYMAAVGGLV VTIAMPVKKN GELLGVVGGD LSLETLVKII       180
     NSVDFGGLGH AFLVSGDGQV IVSPDKDQVM KNLKDIYPNA GVRIEKGNQN VVLNGQERIL       240
     SFTPVAGLPN AEWYIGLSID RDKAYAALSQ FRTSAVIAMF VAVGAIAVFL SLLITVLMRP       300
     LITMGRAMQD IAQGEGDLTR RLVVESKDEF GELGSSFNQF VERIHASISE VSSATRHVHD       360
     LSQRVMASSN ASIIGSDEQS ARTNSVAAAI NQLGAATQEI ARNAADASQH ASGASEQADD       420
     GRQVVEQTIQ AMTELSQKIS LSCTQIETLN ASTDNIGHIL DVIKGISQQT NLLALNAAIE       480
     AARAGEAGRG FAVVADEVRN LAHRTQESAE EIHKMITSLQ VGSREAVTTM NASQASSEET       540
     VEVANQAGLR LVSVTQRIGE IDGMNQSVAA ATEEQTAVVE TLNVDVNQIN LLNQQSVANL       600
     NETLKDCDAL SQQANRLKQL VDSFKI                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page