(data stored in ACNUC7421 zone)

EMBL: CP000094.PE126

CP000094.PE126       Location/Qualifiers
FT   CDS             complement(135065..138454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0126"
FT                   /product="putative amino acid activating peptide synthase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71870"
FT                   /db_xref="GOA:Q3KK36"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK36"
FT                   /protein_id="ABA71870.1"
FT                   /translation="MRRLDILLRGRSQALTDLAQELEQHGHSLLTETAPSMDLVIDDGS
FT                   LAPQDHGTTPYLTLRLGIGATGAGGLPVLDLLCLCNSTLLSRVPIADEPSGNGQALRQR
FT                   ALAQVVDEVALLVSRFSRDAEYFQHAETARAPDFEQVENLLFLDSLAYVHRFNATANPA
FT                   LLQQAQIPVIERLQRSLIEHAERPALHLAEQSISYRQLHDHSRAIQQRLLAMLEAQPQP
FT                   WVVGICLPKCDALFASILAILGSGAVYLPLEPSHPLQRQQYILENAGAVLLLHDGEHPL
FT                   SGSMPGLDVCRIDSTDADLSQPLMHHRPELDTPCMALYTSGTTGHPKGVLLSQANLAHF
FT                   TAWYADYVQLHAESRVLQFSSLSFDSSLIDIFPTLLEGAELVVPDDNQRRDPLQLVALI
FT                   RRRQLTHAFLPPALLSILPLEQLQSVGQIMTGGDVCEPFVIEQLTRQGKLHNLYGPTEA
FT                   TVLITARQLQPGDSNRTLGGPIANSQVLILDDDLQPVPEQTVGELFIVGPGVCLGYLNN
FT                   PQQTAERYLDLELPDGQRLRAYRSGDMAKWGEDGIELCGRRDNQVKIRGFRVEPEEIER
FT                   CLRESQLYRQIAVVIDSQRRILAFLAQPQSDAARETLKAHAQQFLPDYMQPVAWTELPN
FT                   MPFAANGKVDRKALLELPVSVQDSGPKCLPANADEALLLEIWGELLELPISDISTDESF
FT                   FNLGGHSILLSRMLLRLREEFGRSISINRFIELPTITKLATLVRGTDDSAVLSAQAMAD
FT                   AERPLEIEPLPISRMGDVHKVIVTGANSFVGVHIVEALLGWGASEVACLVRDGGGQTAA
FT                   QRFAQSLRENRLEHLDLSRVRIYSADITQPQLGLADGDFERLDREFGALVHNAANVNHV
FT                   LDYESLAADNVEPIFELVRLCEGRSKKVFNFVSTLSASSTVDDAGRVLELPAAPTPPIY
FT                   IRNGYNLSKWVGERILERARERGVRVNLYRPGNISFNSLSGVCQPHKNRLMLMLKGSIQ
FT                   LGQVPAFALNFDLMPVDFLARFIAFHASRYSPERAVFNLHNPEPLSWDAYVASFRETGS
FT                   EFSLVSVADWQQQLGRVDADNALFGVLGFYLNGFEEDIGDISLIGHANAQAGVQQMGAH
FT                   YPEKSPALLRRGCDYLKEINFI"
     MRRLDILLRG RSQALTDLAQ ELEQHGHSLL TETAPSMDLV IDDGSLAPQD HGTTPYLTLR        60
     LGIGATGAGG LPVLDLLCLC NSTLLSRVPI ADEPSGNGQA LRQRALAQVV DEVALLVSRF       120
     SRDAEYFQHA ETARAPDFEQ VENLLFLDSL AYVHRFNATA NPALLQQAQI PVIERLQRSL       180
     IEHAERPALH LAEQSISYRQ LHDHSRAIQQ RLLAMLEAQP QPWVVGICLP KCDALFASIL       240
     AILGSGAVYL PLEPSHPLQR QQYILENAGA VLLLHDGEHP LSGSMPGLDV CRIDSTDADL       300
     SQPLMHHRPE LDTPCMALYT SGTTGHPKGV LLSQANLAHF TAWYADYVQL HAESRVLQFS       360
     SLSFDSSLID IFPTLLEGAE LVVPDDNQRR DPLQLVALIR RRQLTHAFLP PALLSILPLE       420
     QLQSVGQIMT GGDVCEPFVI EQLTRQGKLH NLYGPTEATV LITARQLQPG DSNRTLGGPI       480
     ANSQVLILDD DLQPVPEQTV GELFIVGPGV CLGYLNNPQQ TAERYLDLEL PDGQRLRAYR       540
     SGDMAKWGED GIELCGRRDN QVKIRGFRVE PEEIERCLRE SQLYRQIAVV IDSQRRILAF       600
     LAQPQSDAAR ETLKAHAQQF LPDYMQPVAW TELPNMPFAA NGKVDRKALL ELPVSVQDSG       660
     PKCLPANADE ALLLEIWGEL LELPISDIST DESFFNLGGH SILLSRMLLR LREEFGRSIS       720
     INRFIELPTI TKLATLVRGT DDSAVLSAQA MADAERPLEI EPLPISRMGD VHKVIVTGAN       780
     SFVGVHIVEA LLGWGASEVA CLVRDGGGQT AAQRFAQSLR ENRLEHLDLS RVRIYSADIT       840
     QPQLGLADGD FERLDREFGA LVHNAANVNH VLDYESLAAD NVEPIFELVR LCEGRSKKVF       900
     NFVSTLSASS TVDDAGRVLE LPAAPTPPIY IRNGYNLSKW VGERILERAR ERGVRVNLYR       960
     PGNISFNSLS GVCQPHKNRL MLMLKGSIQL GQVPAFALNF DLMPVDFLAR FIAFHASRYS      1020
     PERAVFNLHN PEPLSWDAYV ASFRETGSEF SLVSVADWQQ QLGRVDADNA LFGVLGFYLN      1080
     GFEEDIGDIS LIGHANAQAG VQQMGAHYPE KSPALLRRGC DYLKEINFI                  1129
//

If you have problems or comments...

PBIL Back to PBIL home page