(data stored in ACNUC7421 zone)

EMBL: CP000094.PE139

CP000094.PE139       Location/Qualifiers
FT   CDS             168134..168994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0139"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71883"
FT                   /db_xref="GOA:Q3KK23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK23"
FT                   /protein_id="ABA71883.1"
FT                   /translation="MNAPLQGHAASNPIATAQALLAVDQVSLEYRTPQRVVRATHQVSF
FT                   EVDQQDRFVLLGPSGCGKSTLLKAVAGFITPCEGEIRLQGQRVDAPGPDRIVVFQEFDQ
FT                   LPPWKTVKQNVMFPLLASRTLKKKEAEERALHYLEKVGLAAFADAYPHTLSGGMKARVA
FT                   IARALAMQPKILLMDEPFAALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEALVVGN
FT                   RILLLSPHPGRVRAEVHSHQYDLHSLGSVAFQESARRIHRLLFDEGQSPETERELDFTD
FT                   IRIAY"
     MNAPLQGHAA SNPIATAQAL LAVDQVSLEY RTPQRVVRAT HQVSFEVDQQ DRFVLLGPSG        60
     CGKSTLLKAV AGFITPCEGE IRLQGQRVDA PGPDRIVVFQ EFDQLPPWKT VKQNVMFPLL       120
     ASRTLKKKEA EERALHYLEK VGLAAFADAY PHTLSGGMKA RVAIARALAM QPKILLMDEP       180
     FAALDALTRR KMQEELLLLW EEVRFTLLFV THSIEEALVV GNRILLLSPH PGRVRAEVHS       240
     HQYDLHSLGS VAFQESARRI HRLLFDEGQS PETERELDFT DIRIAY                      286
//

If you have problems or comments...

PBIL Back to PBIL home page