(data stored in ACNUC7421 zone)

EMBL: CP000094.PE146

CP000094.PE146       Location/Qualifiers
FT   CDS             175893..177212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0146"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71890"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK16"
FT                   /protein_id="ABA71890.1"
FT                   /translation="MNAPVSGAAEQVFARFLDLERQTRAAHDISQLAYSLVNDGQSLFG
FT                   FRHAALLIAGKVQAVTGVSAVEPNAPFVAFVEQAVAQLFKQDVLKQARVITPEMVGESI
FT                   QADWRSLSAMQVFWLPLIDRQGQVFGGLWLARDLPWNPSEQVLLSQLGDTYSHAWLALQ
FT                   PRKPWRLRWTRKRQVALVAVLLLGLLIPVRQSVLAPAEVVPQGGRVVAAPLDGVIAEFL
FT                   VKPNQSVKTGDLLLRFESTTLKAQADVAERALGVAEAELKANSQRSFVDAESSSRVDLL
FT                   AARAEQKRAERDYARELLNRSEVRAERDGIAVFADAERWTGKPVQTGERLMEIADPSQA
FT                   ELRIELAVGDAISLEPGAEVALFLDSDPLQRHLATLERSAYEAQPTAGGQLAYRLDANF
FT                   ADAPPRIGLRGTAKIFGERAPLALYLLRRPLAGLRQSVGL"
     MNAPVSGAAE QVFARFLDLE RQTRAAHDIS QLAYSLVNDG QSLFGFRHAA LLIAGKVQAV        60
     TGVSAVEPNA PFVAFVEQAV AQLFKQDVLK QARVITPEMV GESIQADWRS LSAMQVFWLP       120
     LIDRQGQVFG GLWLARDLPW NPSEQVLLSQ LGDTYSHAWL ALQPRKPWRL RWTRKRQVAL       180
     VAVLLLGLLI PVRQSVLAPA EVVPQGGRVV AAPLDGVIAE FLVKPNQSVK TGDLLLRFES       240
     TTLKAQADVA ERALGVAEAE LKANSQRSFV DAESSSRVDL LAARAEQKRA ERDYARELLN       300
     RSEVRAERDG IAVFADAERW TGKPVQTGER LMEIADPSQA ELRIELAVGD AISLEPGAEV       360
     ALFLDSDPLQ RHLATLERSA YEAQPTAGGQ LAYRLDANFA DAPPRIGLRG TAKIFGERAP       420
     LALYLLRRPL AGLRQSVGL                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page