(data stored in ACNUC7421 zone)

EMBL: CP000094.PE147

CP000094.PE147       Location/Qualifiers
FT   CDS             177213..179309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0147"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71891"
FT                   /db_xref="GOA:Q3KK15"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK15"
FT                   /protein_id="ABA71891.1"
FT                   /translation="MTLPNLRADLQLSPAAPALDGSPRWTLADPVRGRYFKLGAAAMRL
FT                   LRHWSLGDPEQVLRAANREPGLPLDGVELEQLLTFLRGHDLISALDDQQRASYSLKALA
FT                   QRQSLWTILLHQYLFFRIPLWRPDAFLNRAWPWLERFGPRVLRYVLPATLALGVFLVSR
FT                   DWQRFVGTFPHLFSLGGAIAFGISLFFAKLCHEFGHAFMAKRAGCRVQSMGVAFMVLLP
FT                   MFYTDVSDAWRVNDRRARLLIGAGGVLAELLLASIALLVWSFLPDGPGRTAAFMLASAT
FT                   WITTLVVNLNPFMRFDGYFLLSDLWEVDNLQGRAFAFCRWRLREFLFGYGAPAPEPWSP
FT                   TMQRRLLIWGYGSWLWRAALFFGIALAVYHLFFKVLGIFLMLVELVWFIFLPIMSEWRQ
FT                   WWSRREQAHGPRVLLSSLAVLGLLLVLIVPWRSSVELPTMLEGGRASALHAPTAARVKA
FT                   VRVADGQTVAQGDVLIELESPDLDSRQAIVRREIRIQQLLMRRQAGRSETAADAGIVEQ
FT                   RLAEAVAEYRGLTAQRERLLLRAPHAGTVRDLLPNLTPGRWLSSKDALARVVEDGTRLR
FT                   GYLAEAELWRVKPGATGRFIADDPMHAAIAVQLNEIDTNGVAYVDQEALTSDHHGPIAV
FT                   RRDQQHRAEPVQAQYGVRLTTLDQAATPVQPLRGVVVLQGSGESVLGVAWRRMAALGVR
FT                   ESGF"
     MTLPNLRADL QLSPAAPALD GSPRWTLADP VRGRYFKLGA AAMRLLRHWS LGDPEQVLRA        60
     ANREPGLPLD GVELEQLLTF LRGHDLISAL DDQQRASYSL KALAQRQSLW TILLHQYLFF       120
     RIPLWRPDAF LNRAWPWLER FGPRVLRYVL PATLALGVFL VSRDWQRFVG TFPHLFSLGG       180
     AIAFGISLFF AKLCHEFGHA FMAKRAGCRV QSMGVAFMVL LPMFYTDVSD AWRVNDRRAR       240
     LLIGAGGVLA ELLLASIALL VWSFLPDGPG RTAAFMLASA TWITTLVVNL NPFMRFDGYF       300
     LLSDLWEVDN LQGRAFAFCR WRLREFLFGY GAPAPEPWSP TMQRRLLIWG YGSWLWRAAL       360
     FFGIALAVYH LFFKVLGIFL MLVELVWFIF LPIMSEWRQW WSRREQAHGP RVLLSSLAVL       420
     GLLLVLIVPW RSSVELPTML EGGRASALHA PTAARVKAVR VADGQTVAQG DVLIELESPD       480
     LDSRQAIVRR EIRIQQLLMR RQAGRSETAA DAGIVEQRLA EAVAEYRGLT AQRERLLLRA       540
     PHAGTVRDLL PNLTPGRWLS SKDALARVVE DGTRLRGYLA EAELWRVKPG ATGRFIADDP       600
     MHAAIAVQLN EIDTNGVAYV DQEALTSDHH GPIAVRRDQQ HRAEPVQAQY GVRLTTLDQA       660
     ATPVQPLRGV VVLQGSGESV LGVAWRRMAA LGVRESGF                               698
//

If you have problems or comments...

PBIL Back to PBIL home page