(data stored in ACNUC7421 zone)

EMBL: CP000094.PE154

CP000094.PE154       Location/Qualifiers
FT   CDS             complement(186693..187004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK08"
FT                   /protein_id="ABA71898.1"
FT                   /translation="MLQAVQIQHVQPLLGQQRTLYLPDGTALPIRIEYLDEVPAAKTRY
FT                   SERMPFCLEFNSLVPTEFVDGLCALDLPELGRVEDIFVSRVPALGRDPQLGYFCISFN"
     MLQAVQIQHV QPLLGQQRTL YLPDGTALPI RIEYLDEVPA AKTRYSERMP FCLEFNSLVP        60
     TEFVDGLCAL DLPELGRVED IFVSRVPALG RDPQLGYFCI SFN                         103
//

If you have problems or comments...

PBIL Back to PBIL home page