(data stored in ACNUC7421 zone)

EMBL: CP000094.PE155

CP000094.PE155       Location/Qualifiers
FT   CDS             complement(187061..187648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0155"
FT                   /product="Putative phage tail collar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71899"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK07"
FT                   /protein_id="ABA71899.1"
FT                   /translation="MEVFMGTIQPFAFNFAPSGWALCNGQILGISQYQALFALLGTYYG
FT                   GNGTTNFQLPNLQGRVPVAQGTGLGLTPRVIGQVYGTENVTATIANMPNHTHAMTGLTA
FT                   NTALSLAVPASNPATVPTATNSYIGASGGGPGSANIYSDAQGATPVPLKGVTTTVTGDI
FT                   SSTGGSQPLPILNPALVLNFSIALNGLFPSRN"
     MEVFMGTIQP FAFNFAPSGW ALCNGQILGI SQYQALFALL GTYYGGNGTT NFQLPNLQGR        60
     VPVAQGTGLG LTPRVIGQVY GTENVTATIA NMPNHTHAMT GLTANTALSL AVPASNPATV       120
     PTATNSYIGA SGGGPGSANI YSDAQGATPV PLKGVTTTVT GDISSTGGSQ PLPILNPALV       180
     LNFSIALNGL FPSRN                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page