(data stored in ACNUC7421 zone)

EMBL: CP000094.PE161

CP000094.PE161       Location/Qualifiers
FT   CDS             198796..200310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71905"
FT                   /db_xref="GOA:Q3KK01"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK01"
FT                   /protein_id="ABA71905.1"
FT                   /translation="MKKSQKLFGASLLALAISGCAVTSEPIERSVSEQRARADLQSMYK
FT                   GQEPLSGPLTLHQAMARAVKYNLEGRLKIMEEALAKRQLDLASFDMLPRMALDAGYVGR
FT                   NNVSASSSQSVRTGTQSLEPSTSQDRDRDVADLTMVWNVLDFGVSYISAKQQGDQRLIV
FT                   QERRRKVINTIVQDVRSAYWRAMAAERLLKQIDSLMARVDTARRNSESMSEQRIGDPVQ
FT                   SLGYQRSLIEATRQLEEQRRALSLAKTELATLINLPLGTNLTLATDDGYRIPELKVDLS
FT                   KLEQEALTSRPELREQDYQTRISAAETRKAMLRLLPGLEFSAGGHYDSNSFLVEQGWAD
FT                   YGVKVTWNLFNVISAPAAIDVAKAGEEVATARRQAMSIAVLAQLYVANANYQEALRQFK
FT                   TNQQLSDIDGQIVGQLRNRRQADGIGELDLIQGELNTLQADLRRDLSYADLRNAYGQIF
FT                   ASAGLDPLPDQVQSTEVQSIATALANREAAWASGDISLPVAHAAAQ"
     MKKSQKLFGA SLLALAISGC AVTSEPIERS VSEQRARADL QSMYKGQEPL SGPLTLHQAM        60
     ARAVKYNLEG RLKIMEEALA KRQLDLASFD MLPRMALDAG YVGRNNVSAS SSQSVRTGTQ       120
     SLEPSTSQDR DRDVADLTMV WNVLDFGVSY ISAKQQGDQR LIVQERRRKV INTIVQDVRS       180
     AYWRAMAAER LLKQIDSLMA RVDTARRNSE SMSEQRIGDP VQSLGYQRSL IEATRQLEEQ       240
     RRALSLAKTE LATLINLPLG TNLTLATDDG YRIPELKVDL SKLEQEALTS RPELREQDYQ       300
     TRISAAETRK AMLRLLPGLE FSAGGHYDSN SFLVEQGWAD YGVKVTWNLF NVISAPAAID       360
     VAKAGEEVAT ARRQAMSIAV LAQLYVANAN YQEALRQFKT NQQLSDIDGQ IVGQLRNRRQ       420
     ADGIGELDLI QGELNTLQAD LRRDLSYADL RNAYGQIFAS AGLDPLPDQV QSTEVQSIAT       480
     ALANREAAWA SGDISLPVAH AAAQ                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page