(data stored in ACNUC7421 zone)

EMBL: CP000094.PE163

CP000094.PE163       Location/Qualifiers
FT   CDS             200896..201681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71907"
FT                   /db_xref="GOA:Q3KJZ9"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ9"
FT                   /protein_id="ABA71907.1"
FT                   /translation="MSRPAFSRLPLTADLPLLLQALASIDDAAWRGHFNTAYFAGDWSG
FT                   VALISAADALTELSPGSAEPIQRPPWLNDRRWQQALRDLPLEIVSARLLRLGPGGQIHE
FT                   HRDYDLEGADADLRLHIPLLSPPAVDFWLDGQRMPMRAGECWFLDLARPHRVDNRDRTA
FT                   RVHLVLDCRPAPWLEQMIVDGLPSTPLPDATETALQRFQRLLVTEPLLSATLQALHDPE
FT                   AFTVQTLALAAERGLHFSREELLAAMRNGRRSWNEQWRL"
     MSRPAFSRLP LTADLPLLLQ ALASIDDAAW RGHFNTAYFA GDWSGVALIS AADALTELSP        60
     GSAEPIQRPP WLNDRRWQQA LRDLPLEIVS ARLLRLGPGG QIHEHRDYDL EGADADLRLH       120
     IPLLSPPAVD FWLDGQRMPM RAGECWFLDL ARPHRVDNRD RTARVHLVLD CRPAPWLEQM       180
     IVDGLPSTPL PDATETALQR FQRLLVTEPL LSATLQALHD PEAFTVQTLA LAAERGLHFS       240
     REELLAAMRN GRRSWNEQWR L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page