(data stored in ACNUC7421 zone)

EMBL: CP000094.PE164

CP000094.PE164       Location/Qualifiers
FT   CDS             201678..202643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71908"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ8"
FT                   /protein_id="ABA71908.1"
FT                   /translation="MNFDGWLPIRVWKTAEQWQVDWCWFGDTPLHQPFFREAVEDALHL
FT                   PFNQAFRRQTPLSALMDWQTLSPGLLPSAFILHASRCGSTLISQMLARLDDHIVVSEPP
FT                   PLDALLRSDLPDEERRAAIVGLLSAYGQRRRGTEQRLVIKLDAWNIGEWPLLRECFADT
FT                   PWLFVYRDPLEIAVSHLRRPGLHMVPGALGDCVLDDDLPFEGREDFIARRLGRLLEAGC
FT                   VHCRESAGLAVNYSELPDAMSGRLARFFGLSATQCEQALTATAQHAKQPSQPFVVDGEH
FT                   KRREASALLRARIEDCARAPYVALERLRALTISPTDPPYP"
     MNFDGWLPIR VWKTAEQWQV DWCWFGDTPL HQPFFREAVE DALHLPFNQA FRRQTPLSAL        60
     MDWQTLSPGL LPSAFILHAS RCGSTLISQM LARLDDHIVV SEPPPLDALL RSDLPDEERR       120
     AAIVGLLSAY GQRRRGTEQR LVIKLDAWNI GEWPLLRECF ADTPWLFVYR DPLEIAVSHL       180
     RRPGLHMVPG ALGDCVLDDD LPFEGREDFI ARRLGRLLEA GCVHCRESAG LAVNYSELPD       240
     AMSGRLARFF GLSATQCEQA LTATAQHAKQ PSQPFVVDGE HKRREASALL RARIEDCARA       300
     PYVALERLRA LTISPTDPPY P                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page