(data stored in ACNUC7421 zone)

EMBL: CP000094.PE169

CP000094.PE169       Location/Qualifiers
FT   CDS             205566..207629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0171"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71915"
FT                   /db_xref="GOA:Q3KJZ1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ1"
FT                   /protein_id="ABA71915.1"
FT                   /translation="MNGFFSGMPPARDWFYGIRTFAASMTALYIALLMQMPRPYWAMAT
FT                   VYIVSSPFLGPTSSKALYRAIGTFLGAAAAVLFVPMFVQSPYVLVVVIALWTGILLFLS
FT                   LHLRTANNYALMLAGYTLPLIALPVVDNPLAVWDVAESRTEEIFLGIAVAAVVGAMFWP
FT                   RRLAPVFNDAVGKWFADATTYSLKFLSRDVQPEAVAALRMAMVGSFNSLELMIGQLPHE
FT                   GARPQTVRNTKELRGRMIHLLPVIDALEDSLYALERRTPELVEKFAPLLISTREWLGHK
FT                   DADLERWQALRDQLEALQPSAEALEDRKQLLFSNALYRLGEFIDLWQDCRSLQDAILCE
FT                   RQDSWRAVYRHWRLGRLTPFIDRGLMLYSVASTILAIIVASVLWILLGWTDGGSAVILA
FT                   AVSCSFFASMDDPAPQIYRFFFWTGMSVLFASLYLFLVLPNLHDFPMLVLAFAVPFICV
FT                   GTLTVQPRFYLGMLLTLVNTSSFISISGAYDADFFAFVNSNLAGPIGLLFAFIWTLIAR
FT                   PFGAELAAKRLTRFSWKDIVSMTEPANLAEHRQLGVQLLDRLMQHLPRLALTGQDTGIA
FT                   MREVRVGLNLLDLLAYTPRVTGAPNALLKQVVAEVGEYFRACLKAGERLPAPSALLMTM
FT                   DRTRRALSGHGDEDTRLNLLHALSGLRLALLPGVEFVSNAEPEEPLPEGAPL"
     MNGFFSGMPP ARDWFYGIRT FAASMTALYI ALLMQMPRPY WAMATVYIVS SPFLGPTSSK        60
     ALYRAIGTFL GAAAAVLFVP MFVQSPYVLV VVIALWTGIL LFLSLHLRTA NNYALMLAGY       120
     TLPLIALPVV DNPLAVWDVA ESRTEEIFLG IAVAAVVGAM FWPRRLAPVF NDAVGKWFAD       180
     ATTYSLKFLS RDVQPEAVAA LRMAMVGSFN SLELMIGQLP HEGARPQTVR NTKELRGRMI       240
     HLLPVIDALE DSLYALERRT PELVEKFAPL LISTREWLGH KDADLERWQA LRDQLEALQP       300
     SAEALEDRKQ LLFSNALYRL GEFIDLWQDC RSLQDAILCE RQDSWRAVYR HWRLGRLTPF       360
     IDRGLMLYSV ASTILAIIVA SVLWILLGWT DGGSAVILAA VSCSFFASMD DPAPQIYRFF       420
     FWTGMSVLFA SLYLFLVLPN LHDFPMLVLA FAVPFICVGT LTVQPRFYLG MLLTLVNTSS       480
     FISISGAYDA DFFAFVNSNL AGPIGLLFAF IWTLIARPFG AELAAKRLTR FSWKDIVSMT       540
     EPANLAEHRQ LGVQLLDRLM QHLPRLALTG QDTGIAMREV RVGLNLLDLL AYTPRVTGAP       600
     NALLKQVVAE VGEYFRACLK AGERLPAPSA LLMTMDRTRR ALSGHGDEDT RLNLLHALSG       660
     LRLALLPGVE FVSNAEPEEP LPEGAPL                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page