(data stored in ACNUC7421 zone)

EMBL: CP000094.PE17

CP000094.PE17        Location/Qualifiers
FT   CDS             complement(19501..20007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0017"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71761"
FT                   /db_xref="GOA:Q3KKE5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE5"
FT                   /protein_id="ABA71761.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVAVVDDEVRQLVDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDRTEPRVFINPEFESLTDEMEQYQEGCLSVPGFYENVDR
FT                   PQKVKIKALDRDGKPYELIAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIKKKLEKQ
FT                   HRQNA"
     MAILNILEFP DPRLRTIAKP VAVVDDEVRQ LVDDMFETMY EAPGIGLAAT QVNVHKRIVV        60
     MDLSEDRTEP RVFINPEFES LTDEMEQYQE GCLSVPGFYE NVDRPQKVKI KALDRDGKPY       120
     ELIAEGLLAV CIQHECDHLN GKLFVDYLST LKRDRIKKKL EKQHRQNA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page