(data stored in ACNUC7421 zone)

EMBL: CP000094.PE171

CP000094.PE171       Location/Qualifiers
FT   CDS             207832..208719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0173"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71917"
FT                   /db_xref="GOA:Q3KJY9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY9"
FT                   /protein_id="ABA71917.1"
FT                   /translation="MKKPFLTLGRVVLTLLIVTFAVVVVWRMVMYYMFAPWTRDGHIRA
FT                   DIVQIAPDVSGLIQQVEVKDNQLVKRGQVLFSIDQDRFKLALRQARAAVADREETLAQA
FT                   QREAKRNRGLGNLVPAEQLEESLSKVARAQSALAEALVAVDSAQLNLDRSVIRSPVDGY
FT                   VNDRAPRSQEFVTAGRPVLSVVDSNSFHIDGYFEETKLDGIHVGQSVDIRVIGDRARLR
FT                   GHVESIVAGIEDRDRSSGSNLLPNVNPAFSWVRLAQRIPVRIAFDDVPDDFRMIAGRTA
FT                   TVSIIDDQPQEPAK"
     MKKPFLTLGR VVLTLLIVTF AVVVVWRMVM YYMFAPWTRD GHIRADIVQI APDVSGLIQQ        60
     VEVKDNQLVK RGQVLFSIDQ DRFKLALRQA RAAVADREET LAQAQREAKR NRGLGNLVPA       120
     EQLEESLSKV ARAQSALAEA LVAVDSAQLN LDRSVIRSPV DGYVNDRAPR SQEFVTAGRP       180
     VLSVVDSNSF HIDGYFEETK LDGIHVGQSV DIRVIGDRAR LRGHVESIVA GIEDRDRSSG       240
     SNLLPNVNPA FSWVRLAQRI PVRIAFDDVP DDFRMIAGRT ATVSIIDDQP QEPAK            295
//

If you have problems or comments...

PBIL Back to PBIL home page