(data stored in ACNUC7421 zone)

EMBL: CP000094.PE174

CP000094.PE174       Location/Qualifiers
FT   CDS             211087..212592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0176"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71920"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY6"
FT                   /protein_id="ABA71920.1"
FT                   /translation="MNKSAGVLLGIVVAIGAISVGGAWYTGTKIEGVLNNAVANANSEL
FT                   QTAMAGSNGSASLELVSLERNTFSSTAHYRLKGEGEMFGEAPVELLFVDHIEHGPLPFS
FT                   RLVSLKWLPVMATSHFELEKTPITEKWFAATKGAAPLKGVVNIGYDQSTTGNLELLPLE
FT                   TALDDKSNLKFSGLNMDISASAQAQKVKANGYMDSLHLSTVAEDQTPVQIELNGLTLAS
FT                   NLAKSTYGYYTGENTLELTSSKTTFGAKQSVLGVKNFEMKNRTEENGSNASGRADYKVA
FT                   EVTLNDKKIGSANLAMSLKNLDIPSAMSLMQIYQTKLQPYEKAAAEATAAGLPAPELNL
FT                   TEAESTQVKADLQKLLAAGPQLALEDLSLKTANGESRANLVLDLTKPASMDLPPDQLGK
FT                   QLIALLDINVLVSKPMLVDLLSVQAQIDGQTDAKAIVDQASAGADMFAGMAVGSQLATL
FT                   DGTNVVTKLHYAANQVEFNGQKMTVEQFVGFLMSKFGSIEQPQ"
     MNKSAGVLLG IVVAIGAISV GGAWYTGTKI EGVLNNAVAN ANSELQTAMA GSNGSASLEL        60
     VSLERNTFSS TAHYRLKGEG EMFGEAPVEL LFVDHIEHGP LPFSRLVSLK WLPVMATSHF       120
     ELEKTPITEK WFAATKGAAP LKGVVNIGYD QSTTGNLELL PLETALDDKS NLKFSGLNMD       180
     ISASAQAQKV KANGYMDSLH LSTVAEDQTP VQIELNGLTL ASNLAKSTYG YYTGENTLEL       240
     TSSKTTFGAK QSVLGVKNFE MKNRTEENGS NASGRADYKV AEVTLNDKKI GSANLAMSLK       300
     NLDIPSAMSL MQIYQTKLQP YEKAAAEATA AGLPAPELNL TEAESTQVKA DLQKLLAAGP       360
     QLALEDLSLK TANGESRANL VLDLTKPASM DLPPDQLGKQ LIALLDINVL VSKPMLVDLL       420
     SVQAQIDGQT DAKAIVDQAS AGADMFAGMA VGSQLATLDG TNVVTKLHYA ANQVEFNGQK       480
     MTVEQFVGFL MSKFGSIEQP Q                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page