(data stored in ACNUC7421 zone)

EMBL: CP000094.PE177

CP000094.PE177       Location/Qualifiers
FT   CDS             217342..218697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0179"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71923"
FT                   /db_xref="GOA:Q3KJY3"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY3"
FT                   /protein_id="ABA71923.1"
FT                   /translation="MLDRLLALLVLAIVLGVPLGLIFLVTGQFLMDFVFFYPLFMSGLW
FT                   ISGGLYFWLHWERHWPWKDDTLPPPLEGEPLISILIPCYNEGDNAAETIHAALAQHYPN
FT                   IEVIAINDGSRDNTAEVLDALAKEDPRLRVLHLAENQGKAVALRMGAIAARSEYLVCID
FT                   GDALLAPNTAAYLVAPMLDNARLGAVTGNPRIRTRSTLVGRVQVGEFSSIIGLIKRTQR
FT                   VFGRIFTVSGVIVAFRRTALNRVGYWSPDMITEDIDISWKLQLDHWSIFYEPRALCWIL
FT                   MPETLRGLWKQRLRWAQGGAEVLFKNIRGIWQYRHRYLWPLLFEYCLSTGWAFTFLLSV
FT                   IFWAVGKFVVMPEAIAVDHLMPPAFTGLLLAFVCLVQFAVSIVIDRRYEPGLGRTMFWV
FT                   VWYPIAFWLVSLLTTLVSFPKVLFGQHQKRARWVSPDRGIKPLGDDEEEVIK"
     MLDRLLALLV LAIVLGVPLG LIFLVTGQFL MDFVFFYPLF MSGLWISGGL YFWLHWERHW        60
     PWKDDTLPPP LEGEPLISIL IPCYNEGDNA AETIHAALAQ HYPNIEVIAI NDGSRDNTAE       120
     VLDALAKEDP RLRVLHLAEN QGKAVALRMG AIAARSEYLV CIDGDALLAP NTAAYLVAPM       180
     LDNARLGAVT GNPRIRTRST LVGRVQVGEF SSIIGLIKRT QRVFGRIFTV SGVIVAFRRT       240
     ALNRVGYWSP DMITEDIDIS WKLQLDHWSI FYEPRALCWI LMPETLRGLW KQRLRWAQGG       300
     AEVLFKNIRG IWQYRHRYLW PLLFEYCLST GWAFTFLLSV IFWAVGKFVV MPEAIAVDHL       360
     MPPAFTGLLL AFVCLVQFAV SIVIDRRYEP GLGRTMFWVV WYPIAFWLVS LLTTLVSFPK       420
     VLFGQHQKRA RWVSPDRGIK PLGDDEEEVI K                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page