(data stored in ACNUC7421 zone)

EMBL: CP000094.PE180

CP000094.PE180       Location/Qualifiers
FT   CDS             220889..221449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0182"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71926"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY0"
FT                   /protein_id="ABA71926.1"
FT                   /translation="MTRLTSLNPWLAAVAVALCVQFPAQAQERFTLSIPGVSDNRLFTS
FT                   AAASDAAGCGGKNQSPALSWNAGPAGTLSYAIVMHDPDGQKGAGVDHWIHYGIKATTRQ
FT                   IPAGVGAKSALEGVGGTNSKGTTSYVGPCPPVGDSAHHYIIQIYALDLAPDALAAGLTR
FT                   AQLMEKIKGHVLRNSSAVRRYHR"
     MTRLTSLNPW LAAVAVALCV QFPAQAQERF TLSIPGVSDN RLFTSAAASD AAGCGGKNQS        60
     PALSWNAGPA GTLSYAIVMH DPDGQKGAGV DHWIHYGIKA TTRQIPAGVG AKSALEGVGG       120
     TNSKGTTSYV GPCPPVGDSA HHYIIQIYAL DLAPDALAAG LTRAQLMEKI KGHVLRNSSA       180
     VRRYHR                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page