(data stored in ACNUC7421 zone)

EMBL: CP000094.PE181

CP000094.PE181       Location/Qualifiers
FT   CDS             221537..223228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0183"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71927"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX9"
FT                   /protein_id="ABA71927.1"
FT                   /translation="MSLPSTLLRPLAASVLLVVAGCGVSSSPETTVAPPPAQTELKSSV
FT                   QPEAVMADSAMAKRSALTAPIASFAPMPAGESYPQGYRDEQREQYAKLADNPIHSVTET
FT                   PVSTFSADVDTGAYANVRRLLNQGRLPPEGAVRLEEMVNYFPYDYALPSDGSPFGVTTE
FT                   LAASPWNPHTRLLRIGIKASDRAVAELAPANLVFLVDVSGSMDRREGLPLVKSTLKLLV
FT                   DQLREQDRVSLVVYAGESSVVLEPTSGREKAKIRTAIERLTAGGSTAGASGIELAYQMA
FT                   QQAFIPKGINRILLATDGDFNVGTSDFDSLKQMAVDKRKTGISLTTLGFGVDNYNEHLM
FT                   EQLADAGDGNYAYIDNLREARKVLVDQLGSTLAVVAKNVKLQVEFNPAQVSEYRLLGYE
FT                   NRALKREDFSNDKVDAGEIGAGHTVTALYEIVPTGEKGWLEPLRYGKTDAVVSEKRGEL
FT                   AMLRVRYQKPEGGKSLLIERPIASQVAPASEDLRFAAAVAAFSQQLKDGRYTGDFSLKD
FT                   TEALARGARGDDRFGLRNEFVQLVELAQSLRTSTASNGMSTERRIE"
     MSLPSTLLRP LAASVLLVVA GCGVSSSPET TVAPPPAQTE LKSSVQPEAV MADSAMAKRS        60
     ALTAPIASFA PMPAGESYPQ GYRDEQREQY AKLADNPIHS VTETPVSTFS ADVDTGAYAN       120
     VRRLLNQGRL PPEGAVRLEE MVNYFPYDYA LPSDGSPFGV TTELAASPWN PHTRLLRIGI       180
     KASDRAVAEL APANLVFLVD VSGSMDRREG LPLVKSTLKL LVDQLREQDR VSLVVYAGES       240
     SVVLEPTSGR EKAKIRTAIE RLTAGGSTAG ASGIELAYQM AQQAFIPKGI NRILLATDGD       300
     FNVGTSDFDS LKQMAVDKRK TGISLTTLGF GVDNYNEHLM EQLADAGDGN YAYIDNLREA       360
     RKVLVDQLGS TLAVVAKNVK LQVEFNPAQV SEYRLLGYEN RALKREDFSN DKVDAGEIGA       420
     GHTVTALYEI VPTGEKGWLE PLRYGKTDAV VSEKRGELAM LRVRYQKPEG GKSLLIERPI       480
     ASQVAPASED LRFAAAVAAF SQQLKDGRYT GDFSLKDTEA LARGARGDDR FGLRNEFVQL       540
     VELAQSLRTS TASNGMSTER RIE                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page