(data stored in ACNUC7421 zone)

EMBL: CP000094.PE182

CP000094.PE182       Location/Qualifiers
FT   CDS             223228..223839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0184"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71928"
FT                   /db_xref="GOA:Q3KJX8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX8"
FT                   /protein_id="ABA71928.1"
FT                   /translation="MSRLKGFITQLFAFADSLEASSDESLLARYREGDGKAFEILYARH
FT                   RQSLYRFLLGLSGKPELADEVFQETWLSLIRSSSQPQGRATFRTWLFQIARNRLIDHWR
FT                   KHGARQPLHDSYDEQFHAVSDDASDPEQLLNLSRDSERLESALQSLPADQREVFLLRAH
FT                   GDLDLAQIASLTETPLETVKSRLRYAQQKLRRLLAEEVLT"
     MSRLKGFITQ LFAFADSLEA SSDESLLARY REGDGKAFEI LYARHRQSLY RFLLGLSGKP        60
     ELADEVFQET WLSLIRSSSQ PQGRATFRTW LFQIARNRLI DHWRKHGARQ PLHDSYDEQF       120
     HAVSDDASDP EQLLNLSRDS ERLESALQSL PADQREVFLL RAHGDLDLAQ IASLTETPLE       180
     TVKSRLRYAQ QKLRRLLAEE VLT                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page