(data stored in ACNUC7421 zone)

EMBL: CP000094.PE183

CP000094.PE183       Location/Qualifiers
FT   CDS             223836..224438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX7"
FT                   /protein_id="ABA71929.1"
FT                   /translation="MTDARPTPEEQVLKHVREQHNAEPPAHLDALILNAARHETPAPRQ
FT                   SLWQRWLKACQQPRYQVAFASLVGIALMLSLVQRAPEPVAQFDFAPAAKPAAPVARSLS
FT                   APAGALSAPAPAMAPAPMAEMAAPMQSESIRADTLDEAKVSKRAAAPVNGLDEQLREVL
FT                   RLRESGQSQAADSLFSNLHKRYPNVNLDLRLEKIRKN"
     MTDARPTPEE QVLKHVREQH NAEPPAHLDA LILNAARHET PAPRQSLWQR WLKACQQPRY        60
     QVAFASLVGI ALMLSLVQRA PEPVAQFDFA PAAKPAAPVA RSLSAPAGAL SAPAPAMAPA       120
     PMAEMAAPMQ SESIRADTLD EAKVSKRAAA PVNGLDEQLR EVLRLRESGQ SQAADSLFSN       180
     LHKRYPNVNL DLRLEKIRKN                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page