(data stored in ACNUC7421 zone)

EMBL: CP000094.PE19

CP000094.PE19        Location/Qualifiers
FT   CDS             21282..22382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0019"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71763"
FT                   /db_xref="GOA:Q3KKE3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE3"
FT                   /protein_id="ABA71763.1"
FT                   /translation="MMMPVSASVSPAELEARLRLHRLPEVGPKRFAKLLEAFGSASKAI
FT                   SAPASAWRSLGLPAACAEARRCPEVRDGASHALRWLERPDQHLLMWDHPDYPALLAQIP
FT                   DPPPLLFVAGDPRILEKPQLAVIGSRRASRPGMDTAAAFSRSLAGAGFVITSGLALGID
FT                   AAAHQAAVDVGGQTVGVLGTGLENFYPQRNRRLADVMIASGSAVVSEFPLDTGPTASNF
FT                   PRRNRIISGLSLGVLVVEASVASGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIR
FT                   DGAVLVETIEHILEALRGWQHLPVSTAAANPDNPLLRLLHAAPHTSEGLADSSGWALPK
FT                   VLAALTELEMDGRAVCENGRWFARVS"
     MMMPVSASVS PAELEARLRL HRLPEVGPKR FAKLLEAFGS ASKAISAPAS AWRSLGLPAA        60
     CAEARRCPEV RDGASHALRW LERPDQHLLM WDHPDYPALL AQIPDPPPLL FVAGDPRILE       120
     KPQLAVIGSR RASRPGMDTA AAFSRSLAGA GFVITSGLAL GIDAAAHQAA VDVGGQTVGV       180
     LGTGLENFYP QRNRRLADVM IASGSAVVSE FPLDTGPTAS NFPRRNRIIS GLSLGVLVVE       240
     ASVASGSLIT ARLAAEQGRE VYAIPGSIHH PGARGCHQLI RDGAVLVETI EHILEALRGW       300
     QHLPVSTAAA NPDNPLLRLL HAAPHTSEGL ADSSGWALPK VLAALTELEM DGRAVCENGR       360
     WFARVS                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page