(data stored in ACNUC7421 zone)

EMBL: CP000094.PE192

CP000094.PE192       Location/Qualifiers
FT   CDS             234493..235506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0194"
FT                   /product="sulfate ABC transport system, sulfate-binding
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71938"
FT                   /db_xref="GOA:Q3KJW8"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW8"
FT                   /protein_id="ABA71938.1"
FT                   /translation="MSSIRRYALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNA
FT                   EFVKYWQSEHAGDTVKIQQSHGGSGKQGRAVIDGLRADVVTLALAGDIDEIAKLGKTLP
FT                   ADWQKRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLIKNDVSVITPNPKTSGGARWNFL
FT                   AAWAYGLKANGGNEAKAKEYVQTLFKHVPVLDTGARGSTITFVNNGQGDVLLAWENEAF
FT                   LALKEDGGKDKFDIVVPSLSILAEPPVAVVDKNAEKKGNEQIAEAYLKHLYSPAGQEIA
FT                   AKNFYRPRDKDVAAKYAQQFPKLELVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
     MSSIRRYALA ALASAVFAGS AVAKDYELLN VSYDPTRELY QDYNAEFVKY WQSEHAGDTV        60
     KIQQSHGGSG KQGRAVIDGL RADVVTLALA GDIDEIAKLG KTLPADWQKR LPDASTPYTS       120
     TIVFLVRKGN PKGIKDWGDL IKNDVSVITP NPKTSGGARW NFLAAWAYGL KANGGNEAKA       180
     KEYVQTLFKH VPVLDTGARG STITFVNNGQ GDVLLAWENE AFLALKEDGG KDKFDIVVPS       240
     LSILAEPPVA VVDKNAEKKG NEQIAEAYLK HLYSPAGQEI AAKNFYRPRD KDVAAKYAQQ       300
     FPKLELVTID KDFGGWKTAQ PKFFNDGGVF DQIYQAQ                                337
//

If you have problems or comments...

PBIL Back to PBIL home page