(data stored in ACNUC7421 zone)

EMBL: CP000094.PE193

CP000094.PE193       Location/Qualifiers
FT   CDS             235577..236395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0195"
FT                   /product="sulfate ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71939"
FT                   /db_xref="GOA:Q3KJW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW7"
FT                   /protein_id="ABA71939.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWTIISAPRVLAALKLSFGTALCAAIINGIIGTLLAWVLVRYTFPGRKVIDAMIDLPFA
FT                   LPTAVAGIALTALYTPTGLVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGAKPLQVFRHILLPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATSIGVLMLVVSFVLLLLINLLQRRIETP"
     MSRRISPVIP GFGLTLGYTL VYLSLIVLIP LAAMFVHAAQ LTWDQFWTII SAPRVLAALK        60
     LSFGTALCAA IINGIIGTLL AWVLVRYTFP GRKVIDAMID LPFALPTAVA GIALTALYTP       120
     TGLVGQFAAD LGFKIAYTPL GITLALTFVT LPFVVRTVQP VLADIPREVE EAAACLGAKP       180
     LQVFRHILLP ALLPAWLTGF ALAFARGVGE YGSVIFIAGN MPMKTEILPL LIMVKLDQYD       240
     YTGATSIGVL MLVVSFVLLL LINLLQRRIE TP                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page