(data stored in ACNUC7421 zone)

EMBL: CP000094.PE195

CP000094.PE195       Location/Qualifiers
FT   CDS             237285..238274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0197"
FT                   /product="sulfate/thiosulfate ABc transport system,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71941"
FT                   /db_xref="GOA:Q3KJW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW5"
FT                   /protein_id="ABA71941.1"
FT                   /translation="MSIEVRNVSKNFNAFKALDNISLDIHSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDNGNIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   NQRPNESQIATKVHELLNMVQLDWLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   DVYENPASDFVYHFLGDSNRLHLGDDNHVLFRPHEVSLSRHELEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQTDLIEAEVVKDHDSLTGLAKGETLFFKPKVWQKVANV"
     MSIEVRNVSK NFNAFKALDN ISLDIHSGEL VALLGPSGCG KTTLLRIIAG LETPDNGNIV        60
     FHGEDVSGHD VRDRNVGFVF QHYALFRHMT VFDNVAFGLR MKPKNQRPNE SQIATKVHEL       120
     LNMVQLDWLS DRYPEQLSGG QRQRIALARA LAVEPKVLLL DEPFGALDAK VRKELRRWLA       180
     RLHEDINLTS VFVTHDQEEA MEVADRIVVM NKGVIEQIGS PGDVYENPAS DFVYHFLGDS       240
     NRLHLGDDNH VLFRPHEVSL SRHELEDHHA AEVRDIRPLG ATTRVTLKVE GQTDLIEAEV       300
     VKDHDSLTGL AKGETLFFKP KVWQKVANV                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page