(data stored in ACNUC7421 zone)

EMBL: CP000094.PE197

CP000094.PE197       Location/Qualifiers
FT   CDS             239008..239691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0199"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71943"
FT                   /db_xref="GOA:Q3KJW3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW3"
FT                   /protein_id="ABA71943.1"
FT                   /translation="MDKVWRERLLTGQWFSHLPSSFQDSLLAAARERRLAAGQRLFQRG
FT                   DAPCGLYAVLDGAVRIGAVSEQGKEALLSLVEAPHWFGEICLFDGQPRTHDAYAVGPCT
FT                   LLNIPQATLLKLLDEQPVYWRHLALLMSHKLRLTFINLEQLSLLPAPARLAHRLLMIAE
FT                   GYGELDPPRRVLQLPQEQLASMLSLSRQTTNQILKELQGQGVIGLSYGEIEILDAARLR
FT                   ALATL"
     MDKVWRERLL TGQWFSHLPS SFQDSLLAAA RERRLAAGQR LFQRGDAPCG LYAVLDGAVR        60
     IGAVSEQGKE ALLSLVEAPH WFGEICLFDG QPRTHDAYAV GPCTLLNIPQ ATLLKLLDEQ       120
     PVYWRHLALL MSHKLRLTFI NLEQLSLLPA PARLAHRLLM IAEGYGELDP PRRVLQLPQE       180
     QLASMLSLSR QTTNQILKEL QGQGVIGLSY GEIEILDAAR LRALATL                     227
//

If you have problems or comments...

PBIL Back to PBIL home page