(data stored in ACNUC7421 zone)

EMBL: CP000094.PE201

CP000094.PE201       Location/Qualifiers
FT   CDS             241469..242857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0203"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71947"
FT                   /db_xref="GOA:Q3KJV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV9"
FT                   /protein_id="ABA71947.1"
FT                   /translation="MRARSIAWRLALAFAAVCALVLSAIGVFLYRSLAAEIAWRDDMAL
FT                   LGRLEQVRALLADSDSLDALQARPRLYQNMLGNLDSLLLVQRADGSNVITINPRQRALP
FT                   SVQAIPRDQPPQRRDVLTWQAADGVELALLSGQAQGPNGEALTVIAGKVLSEREQMLGS
FT                   YRLRLYLAVGLGAVLAFTLGLVLLRRGLRPLRKLSEALRGIDLRSLDQRVPTAGTPAEL
FT                   LEPVHALNGMLGRLDDGFQRLSQFSADLAHEIRTPLHTLLASNGQALNYPRSSAEYQEV
FT                   LASNMEEFERLKRMAENLMFLARAEQAERALDLRTLELHEIGDELCDYFEALADDREIR
FT                   LENTFSGELLADQQLLQRALGNLLANAVRHADAGSVISLRRRDEPGLCWLQVHNLGPVI
FT                   ADEHLGKLFDRFYRVDPSRAEPGDSGGLGLAIVQSIMRLHGGQVRVSSDATGTVFELGF
FT                   VTSR"
     MRARSIAWRL ALAFAAVCAL VLSAIGVFLY RSLAAEIAWR DDMALLGRLE QVRALLADSD        60
     SLDALQARPR LYQNMLGNLD SLLLVQRADG SNVITINPRQ RALPSVQAIP RDQPPQRRDV       120
     LTWQAADGVE LALLSGQAQG PNGEALTVIA GKVLSEREQM LGSYRLRLYL AVGLGAVLAF       180
     TLGLVLLRRG LRPLRKLSEA LRGIDLRSLD QRVPTAGTPA ELLEPVHALN GMLGRLDDGF       240
     QRLSQFSADL AHEIRTPLHT LLASNGQALN YPRSSAEYQE VLASNMEEFE RLKRMAENLM       300
     FLARAEQAER ALDLRTLELH EIGDELCDYF EALADDREIR LENTFSGELL ADQQLLQRAL       360
     GNLLANAVRH ADAGSVISLR RRDEPGLCWL QVHNLGPVIA DEHLGKLFDR FYRVDPSRAE       420
     PGDSGGLGLA IVQSIMRLHG GQVRVSSDAT GTVFELGFVT SR                          462
//

If you have problems or comments...

PBIL Back to PBIL home page