(data stored in ACNUC7421 zone)

EMBL: CP000094.PE208

CP000094.PE208       Location/Qualifiers
FT   CDS             complement(249295..250893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0210"
FT                   /product="putative ABC sulfur transport system, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71954"
FT                   /db_xref="GOA:Q3KJV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV2"
FT                   /protein_id="ABA71954.1"
FT                   /translation="MARESLLSLPLAAPPLKSRRTWPSLSHRVLPWILPLGLFALWWLA
FT                   ARNQWMSEQILPAPSLVWNSAIELSQGELWSHLWISLQRLFWGLLAGVSAGAMLGAALG
FT                   FSRRLERLIFPTFAGLAQVPTLAWIPLFMVFFGIGETLKLVVLVKAIVVPVTLHTLVGV
FT                   RDAQPKLREAAAVLRLPPRLLIRRLVLPAALPAFMAGVRLALAAGWTSLLAVELLASSE
FT                   GIGYLMVWARQLFMLDIVFVCIVVIGLIGVAMDRGIGLLDKKLVHWPHPATAEIRRGPR
FT                   YEGWQRVQPWLLPLALFALWQLAVDQQWIDANILVSPWVVLEATKNGLLDGTLISGMAL
FT                   SLGRTLGGLLIGGGLGLVLGLLLGLSRTSERVLGPTLAALRQIAIFAWVPLLTAWFGLG
FT                   ELAKWVFVALAAFFPLFVATQRSVANLSPQLNEAAQVLRLSLAQRLLRLVLPGAAPGIF
FT                   AGLRLSLIYAWLGTIGAEYFMPSNGGIGSQMIGAQQLLRMDLIMAGMLLVGLTGALLNL
FT                   IGQRLEIRATRWRHA"
     MARESLLSLP LAAPPLKSRR TWPSLSHRVL PWILPLGLFA LWWLAARNQW MSEQILPAPS        60
     LVWNSAIELS QGELWSHLWI SLQRLFWGLL AGVSAGAMLG AALGFSRRLE RLIFPTFAGL       120
     AQVPTLAWIP LFMVFFGIGE TLKLVVLVKA IVVPVTLHTL VGVRDAQPKL REAAAVLRLP       180
     PRLLIRRLVL PAALPAFMAG VRLALAAGWT SLLAVELLAS SEGIGYLMVW ARQLFMLDIV       240
     FVCIVVIGLI GVAMDRGIGL LDKKLVHWPH PATAEIRRGP RYEGWQRVQP WLLPLALFAL       300
     WQLAVDQQWI DANILVSPWV VLEATKNGLL DGTLISGMAL SLGRTLGGLL IGGGLGLVLG       360
     LLLGLSRTSE RVLGPTLAAL RQIAIFAWVP LLTAWFGLGE LAKWVFVALA AFFPLFVATQ       420
     RSVANLSPQL NEAAQVLRLS LAQRLLRLVL PGAAPGIFAG LRLSLIYAWL GTIGAEYFMP       480
     SNGGIGSQMI GAQQLLRMDL IMAGMLLVGL TGALLNLIGQ RLEIRATRWR HA               532
//

If you have problems or comments...

PBIL Back to PBIL home page