(data stored in ACNUC7421 zone)

EMBL: CP000094.PE209

CP000094.PE209       Location/Qualifiers
FT   CDS             251198..252211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0211"
FT                   /product="putative ABC sulfu transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71955"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV1"
FT                   /protein_id="ABA71955.1"
FT                   /translation="MNLPFKRVISLFAAPALAGLLAFSAQADELKEIRIAVPDLSAGTQ
FT                   HSGGGIVDVLRDQQIFEKAFADQGIKIQWSFFKGAGPVINEAFANGQVDLAYLGDLAAI
FT                   IGKSNGLDTRLLSASARGVKQYLGVVPGSGIKTLQDLKGKRVAIFRGTATQLSFDAALA
FT                   SVGLSEKDVKVINLDFNAAVAALAAKQIDASWGSSGLTALQAKGLAELPLNTKDLGGAG
FT                   SVQSVLVGTGKFVDGHPEAVAKLLKAQQQAVEWLTQDSNKDAYVQLVSGLASYPPVILT
FT                   QDLKDQNLSEVFPSTLDPLFLENLQGKVDLAAQQKLIRKPFKVNEWVAPELAAAKL"
     MNLPFKRVIS LFAAPALAGL LAFSAQADEL KEIRIAVPDL SAGTQHSGGG IVDVLRDQQI        60
     FEKAFADQGI KIQWSFFKGA GPVINEAFAN GQVDLAYLGD LAAIIGKSNG LDTRLLSASA       120
     RGVKQYLGVV PGSGIKTLQD LKGKRVAIFR GTATQLSFDA ALASVGLSEK DVKVINLDFN       180
     AAVAALAAKQ IDASWGSSGL TALQAKGLAE LPLNTKDLGG AGSVQSVLVG TGKFVDGHPE       240
     AVAKLLKAQQ QAVEWLTQDS NKDAYVQLVS GLASYPPVIL TQDLKDQNLS EVFPSTLDPL       300
     FLENLQGKVD LAAQQKLIRK PFKVNEWVAP ELAAAKL                                337
//

If you have problems or comments...

PBIL Back to PBIL home page