(data stored in ACNUC7421 zone)

EMBL: CP000094.PE210

CP000094.PE210       Location/Qualifiers
FT   CDS             complement(252251..253186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0212"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71956"
FT                   /db_xref="GOA:Q3KJV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV0"
FT                   /protein_id="ABA71956.1"
FT                   /translation="MPEKHMDLRQLRYFIALNEHRSFVRAADAMGITQPAFSRSIQGLE
FT                   QEFGCVLVDRGNKDLRPTPEGQVVLQHALTLVQGAALLSAEVTQMTKLDAGELHFGCGP
FT                   APAVKLVPDAVAQFINAHPKVRTCFQVDNWEKLSRALSREEIEFFIADIRHFESDPNFQ
FT                   TQPLTPKRGVFFCRPGHPLLAKESLSTNDMFDYPLATTLIPPGIRKLLANLSGRIDFSP
FT                   TIETEHFPALVKVVLQSNAIGVGTEEAFVEDIAQGSLALLHWRNLPQNLESMNARCGIV
FT                   SRTGFRLSPAARAMIETLVAVDKQAISVAV"
     MPEKHMDLRQ LRYFIALNEH RSFVRAADAM GITQPAFSRS IQGLEQEFGC VLVDRGNKDL        60
     RPTPEGQVVL QHALTLVQGA ALLSAEVTQM TKLDAGELHF GCGPAPAVKL VPDAVAQFIN       120
     AHPKVRTCFQ VDNWEKLSRA LSREEIEFFI ADIRHFESDP NFQTQPLTPK RGVFFCRPGH       180
     PLLAKESLST NDMFDYPLAT TLIPPGIRKL LANLSGRIDF SPTIETEHFP ALVKVVLQSN       240
     AIGVGTEEAF VEDIAQGSLA LLHWRNLPQN LESMNARCGI VSRTGFRLSP AARAMIETLV       300
     AVDKQAISVA V                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page